The short version of glutathione fits in a sentence. The long version — which is the one that helps — is below.
This page was last updated on 2025-12-11 and is reviewed periodically as new material appears.
Glutathione is a tripeptide composed of glutamate, cysteine, and glycine. The peptide bond between glutamate and cysteine uses the gamma-carboxyl group of glutamate rather than the alpha-carboxyl group. This unusual linkage protects the molecule from many common peptidases. The cysteine side chain carries a thiol group that can undergo reversible oxidation. Because of this thiol, glutathione participates in redox reactions and helps maintain the reducing environment inside most cells in living systems.
In cells, glutathione exists mainly in a reduced form called GSH. When two GSH molecules react, they form oxidized glutathione, or GSSG, which contains a disulfide bond. The ratio of GSH to GSSG is often used as an indicator of oxidative stress. Enzymes such as glutathione peroxidase and glutathione reductase help cycle the molecule between these two states. This cycling supports antioxidant defense, detoxification of reactive molecules, and regulation of certain signaling pathways.
Glutathione is present in most tissues, with especially high concentrations in the liver. It also serves as a cofactor for some enzymes and helps transport amino acids across cell membranes. In plants and microorganisms, glutathione contributes to stress responses and metal handling. The molecule is synthesized in two ATP-dependent steps, first producing gamma-glutamylcysteine and then adding glycine. Because cysteine availability often limits synthesis, dietary and metabolic factors can influence glutathione levels. Research continues to examine how these levels relate to health and disease.
Glutathione is a tripeptide composed of glutamate, cysteine, and glycine. It contains an unusual gamma-glutamyl bond between glutamate and cysteine, which resists cleavage by many peptidases. The reduced form, GSH, carries a thiol group on cysteine and is the dominant intracellular form in most cells. Its structure allows it to participate in redox reactions and to serve as a sulfur donor. The oxidized form, GSSG, consists of two GSH molecules joined by a disulfide bond.
In cells, glutathione helps maintain the reducing environment of the cytosol and supports enzymes that counteract reactive oxygen species. It acts as a cofactor for glutathione peroxidases, which reduce hydrogen peroxide and lipid peroxides, and for glutathione S-transferases, which conjugate electrophiles. The ratio of GSH to GSSG is often used as an indicator of oxidative stress, although the ratio can vary by compartment and cell type. Glutathione also stores cysteine, an amino acid that can be limiting for protein synthesis and antioxidant defense.
| Property | Value | Notes |
|---|---|---|
| Common name | Glutathione | Tripeptide of glutamate, cysteine, and glycine |
| Reduced form | GSH | Dominant intracellular thiol |
| Oxidized form | GSSG | Disulfide-linked dimer |
| Molar mass | 307.32 g/mol | For reduced glutathione |
| Functional motif | Gamma-glutamyl-cysteinyl-glycine | Gamma linkage resists many peptidases |
Glutathione is a tripeptide composed of glutamate, cysteine, and glycine. Its glutamate-cysteine linkage uses the gamma-carboxyl group of glutamate, a feature that resists standard peptidases. The cysteine residue provides a thiol group, which gives the molecule its reducing character. In cells, glutathione is often the most abundant small-molecule thiol, with concentrations varying widely by tissue and compartment. It exists mainly in a reduced form called GSH, while oxidation produces a disulfide-linked dimer called GSSG.
Biosynthesis proceeds in two ATP-dependent steps. First, glutamate-cysteine ligase joins glutamate and cysteine. Second, glutathione synthetase adds glycine to the intermediate. The pathway is regulated by cysteine availability, enzyme expression, and feedback inhibition by glutathione itself. Liver tissue has a particularly high capacity for synthesis and export. Because the molecule is made inside cells, circulating glutathione reflects a balance of release, uptake, and breakdown rather than simple dietary supply.
Glutathione is a small tripeptide composed of glutamate, cysteine, and glycine, with the unusual gamma-glutamyl linkage between glutamate and cysteine. Its cysteine thiol group makes it a major non-enzymatic antioxidant in cells. The reduced form, GSH, predominates in most intracellular compartments, while the oxidized disulfide form, GSSG, is produced when GSH reduces reactive oxygen species. Intracellular concentrations often reach millimolar levels, whereas plasma concentrations are much lower, typically in the low micromolar range. This gradient reflects active synthesis, transport, and consumption rather than passive distribution.
Synthesis occurs in two ATP-dependent steps: glutamate-cysteine ligase joins glutamate and cysteine to form gamma-glutamylcysteine, and glutathione synthetase adds glycine to complete the tripeptide. The pathway is feedback-inhibited by GSH and limited by cysteine availability, so cysteine supply often constrains production. Once formed, GSH participates in redox buffering, xenobiotic conjugation, and protein glutathionylation. Glutathione peroxidase uses GSH to reduce hydrogen peroxide and lipid peroxides, yielding GSSG, while glutathione reductase regenerates GSH using NADPH. Glutathione S-transferases conjugate electrophiles to GSH, supporting detoxification and excretion.
Several analytical methods can quantify glutathione, including high-performance liquid chromatography (HPLC) with UV or fluorescence detection for separating GSH and GSSG. Liquid chromatography-tandem mass spectrometry (LC-MS/MS) offers higher specificity and sensitivity, often detecting nanomolar concentrations. The enzymatic recycling assay, often called the Tietze method, measures total glutathione by coupling reduction of GSSG to a colorimetric or fluorometric readout. Capillary electrophoresis and electrochemical detection are also used in specialized laboratories. Each method has distinct advantages and limitations regarding throughput, cost, and susceptibility to interference.
Interpreting glutathione measurements requires attention to pre-analytical variables. The GSSG concentration in a sample can rise artificially during storage or processing, making the GSH/GSSG ratio unreliable if not controlled. Reference ranges vary by specimen type, assay, and population, so comparisons across studies are difficult. Plasma glutathione is low and sensitive to hemolysis, while whole blood reflects primarily erythrocyte content. Many studies measure total glutathione rather than the reduced and oxidized forms separately, which limits conclusions about redox status.
Beak trimming (also spelled as beak-trimming; informally as debeaking), or beak conditioning, is the partial removal of the beak of poultry, especially layer hens and turkeys, although it is also performed on some quail and ducks. When multiple birds are confined in small spaces, they are more likely to hurt each other through pecking. Beak trimming aims to avoid damage done by pecking, although the practice is criticized by animal welfare organizations and banned in several European countries. Beak trimming is most common in egg-laying strains of chickens. In some countries, such as the United States, turkeys routinely have their beaks trimmed. In the UK, only 10% of turkeys are beak trimmed. In close confinement, cannibalism, feather pecking and aggression are common among turkeys, ducks, pheasants, quail, and chickens of many breeds (including both heritage breeds and modern hybrids) kept for eggs. The tendency to cannibalism and feather pecking varies among different strains of chickens, but does not manifest itself consistently. Some flocks of the same breed may be entirely free from cannibalism, while others, under the same management, may have a serious outbreak. Mortalities, mainly due to cannibalism, can be up to 15% in egg laying flocks housed in aviaries, straw yards, and free-range systems. Because egg laying strains of chickens can be kept in smaller group sizes in caged systems, cannibalism is reduced leading to a lowered trend in mortality as compared to non-cage systems.
These non-peptide inhibitors can be more stable than inhibitors containing peptide bonds, because they will not be substrates for peptidases and are less likely to be degraded. In drug design it is important to consider the concentrations of substrates to which the target enzymes are exposed. For example, some protein kinase inhibitors have chemical structures that are similar to ATP, one of the substrates of these enzymes. However, drugs that are simple competitive inhibitors will have to compete with the high concentrations of ATP in the cell. Protein kinases can also be inhibited by competition at the binding sites where the kinases interact with their substrate proteins, and most proteins are present inside cells at concentrations much lower than the concentration of ATP. As a consequence, if two protein kinase inhibitors both bind in the active site with similar affinity, but only one has to compete with ATP, then the competitive inhibitor at the protein-binding site will inhibit the enzyme more effectively.
=== Toxic exposure === Multiple studies have attempted to study the relationship between toxic exposure and autism, despite limitations related to the measurement of toxic exposure the methods for which were often indirect and cross-sectional. Systematic reviews have been conducted for numerous toxins including air pollution, thimerosal, inorganic mercury, and levels of heavy metals in hair, nails, and bodily fluids. Environmental exposure to inorganic mercury may be associated with higher autism risk, with high levels of mercury in the body being a valid disease-causing agent for autism. Significant evidence has not been found of an association between autism and the concentration of copper, cadmium, selenium, and chromium in the hair, nails, and bodily fluids. Levels of lead were found to be significantly higher in individuals with autism. The precision and consistency of results were not maintained across studies and were influenced by an outlier study. The atypical eating behaviors of autistic children, along with habitual mouthing and pica, make it hard to determine whether increased lead levels are a cause or a consequence of autism.
Sources: en.wikipedia.org
A minority of fadas specifically delineate boundaries, such as by placing line of bricks or a slab of cement, while a few meet under thatched coverings, whose construction may be sponsored by political candidates. Permanent structures are rare. When a meeting is not active, the only indicator of a fada's place is a wall painted with the group's name. Most fadas have a single inscription, but some write on two or more nearby walls. They generally prefer large, smooth walls but may have to work around things such as windows. Some walls may contain the inscriptions of multiple fadas that share the space. As paint begins to fade, a fada may attempt to restore it, causing multiple layers of paint to be visible. Inscriptions from former fadas either fade away or get painted over by new fadas in the same spot. Fadas' places are both public, being part of the street, and private, being occupied only by a fada. Despite being publicly visible, they resemble domestic spaces like courtyards where people meet privately. Their presence make youths visible, trangressing norms of public space as being controlled by elders. According to Masquelier, it enables youths with little social power to define new places, exemplifying the right to the city. A fada's members are expected to be present every day; an absence may spark concern among fellow fadantchés. Whenever a member arrives, the rest of the fada pauses their activities to greet them with a handshake and give them a seat.
15-Oxo-ETE). Other eicosanoid oxoreductases that use NAD+ and NADH as co-factors include: 12-hydroxyicosatetraenoate dehydrogenase which metabolizes 12-hydroxyeicosatetraenoic acid (12-HETE) and LTB4 to their corresponding 12-oxo analogs and 11-hydroxy-TXB2 dehydrogenase, which metabolizes TXB2 to its 11-oxo analog; and 15-hydroxyprostaglandin dehydrogenase (NAD+) which metabolizes (5Z,13E)-(15S)-11alpha,15-dihydroxy-9-oxoprost-13-enoate to its 15-oxo analog. Other eicosanoid oxireductases that use NADP+ and NADPH as cofactors include LTB4 12-hydroxy dehydrogenase which metabolizes LTB4 to its 12-oxo analog, and 15-hydroxyprostaglandin-D dehydrogenase (NADP+), 15-hydroxyprostaglandin-I dehydrogenase (NADP+), and 15-hydroxyprostaglandin dehydrogenase (NADP+) which metabolize PGD2, PGI2, and (13E)-(15S)-11alpha,15-dihydroxy-9-oxoprost-13-enoate, respectively, to their corresponding 15-oxo analogs.
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.
Sources: en.wikipedia.org
Glutathione is a tripeptide made from glutamate, cysteine, and glycine. Its cysteine residue provides a thiol group that is central to its redox activity. The glutamate-cysteine bond forms through the gamma-carboxyl group of glutamate.
Reduced glutathione, GSH, can donate electrons and become oxidized to GSSG. The balance between these forms reflects the cell's redox environment. A shift toward GSSG is commonly interpreted as evidence of oxidative stress, though the ratio can vary by tissue and method.
Glutathione occurs in nearly all cell types, with notable amounts in the liver. It is also present in the lungs, kidneys, and red blood cells. Concentrations differ among tissues and change with age, diet, and disease states.
GSH is the reduced form with a free thiol group, while GSSG is the oxidized disulfide-linked dimer. Most assays distinguish the two because their balance reflects redox conditions. The names are not interchangeable.